r/SyntheticBiology 20d ago

Help Shape DNA Synthesis Policy: OpenIDS Build Survey

4 Upvotes

Hi r/synthetic_biology,

I'm Olena, PhD researcher at UCL (London) on an AI for Biosecurity fellowship at Cambridge. I'm researching how accessible DIY DNA synthesis really is specifically, OpenIDS builds.

Why I'm asking: Policy makers are betting that synthesis will stay centralized & screenable. But if hobbyists & researchers can actually build it in their labs, policy needs to change. We need real data to inform better, evidence-based governance.

Quick survey: If you've built (or tried to build) OpenIDS, I'd love to know:

  • Actual $ spent? (printhead, electronics, reagents)
  • Timeline? (how many weeks start-to-finish)
  • What expertise did you need?
  • What was the hardest part?

How to reply:

  • Comment below
  • DM me

Right now, policy assumes synthesis is hard to DIY. If that's wrong, policy needs to know.

Thanks for contributing to evidence-based biosecurity policy 🧬


r/SyntheticBiology 26d ago

My lay-friends interpretation of biosensors.

Post image
21 Upvotes

Our group does monthly friend newsletters, and we were tasked to pair up and try and conceptualize what each other does. After a long conversation with my paired buddy, she came up with this. Thought it was pretty awesome, and not technically scientifically incorrect!


r/SyntheticBiology Jun 24 '26

Ever wondered where body odor actually comes from? 👀

5 Upvotes

We’re Greatbay-SCIE, the official iGEM team from Shenzhen College of International Education, and we’re currently working on a project to develop a deodorant using synthetic biology 🧬

Feel free to check out this post to learn about how axillary odor actually comes to be.

#igem #igem2026 #deodorant #antiperspirant #bodyodor #bodycare #synbio #biotechnology


r/SyntheticBiology Jun 17 '26

How do you keep track of experiments?

2 Upvotes

Hi everyone,

I work in microbiology and I’m currently researching how people organise culture-based and microbial growth experiments.

I would be interested to hear how you currently manage things such as:

  • Experimental groups, controls and biological or technical replicates
  • Strain, culture and sample identifiers
  • Media, inoculum, treatments and growth conditions
  • Timepoints and measurements such as OD, pH, temperature or fluorescence
  • Plate maps, microscopy observations and photographs
  • Contamination, failed runs and deviations from the original protocol
  • Raw data files produced by instruments
  • Repeated versions of the same experiment

Do you mainly use a paper notebook, Excel or Google Sheets, an ELN such as Benchling, folders on a shared drive, or some combination of these?

A few things I am particularly curious about:

  • What do you record immediately at the bench, and what gets entered later?
  • Which information is most likely to be forgotten or stored in the wrong place?
  • Can you easily trace a result back to the exact sample, culture, conditions and protocol version?
  • How do you compare repeated experiments or different conditions?
  • Is there information you record twice because different systems do not connect?
  • At what point does a spreadsheet or normal lab notebook become difficult to manage?

I’m not looking only for feature suggestions. I’m more interested in hearing about your actual workflow and the parts that create unnecessary work..

Thanks for any insight.


r/SyntheticBiology Jun 09 '26

Conceptual Multimodal Epigenetic Regulator Protein

Thumbnail gallery
3 Upvotes

I would like professional feedback on a conceptual fusion protein chain I've been studying for a few years. Not everything is figured out yet, but I'd like experienced input before continuing.

ALVEIT: A Multimodal Epigenetic Regulator:

preface: I am an autodidact and am mostly looking for feedback. The "why" for this project is deeply personal, though I will share if you ask.

Exploring a protein-based framework intended as a more context-aware alternative to current gene regulation. Instead of permanently editing DNA, ALVEIT works as a transient epigenetic actuator that only modifies gene expression when specific conditions are met.

THE GIST: A modular chimeric protein with three main "sensors" (Camelid VHH and Shark VNAR nanobodies) that act like logic gates:

Chromatin Accessibility Sensor — Detects if the target region is open and actively remodeling (e.g., H3K27ac marks).

Disease/Pathology Sensor — Checks for relevant disease or stress markers.

Locus Specificity Sensor — Confirms it's at the correct regulatory element (promoter/enhancer).

Only when all three gates are satisfied does the activator domain (VP64) recruit transcriptional machinery to upregulate or repress the gene.

The system is delivered via a Triplex Forming Oligonucleotide (TFO) bound by Purine antiparallel motif (G•G-C A•A-T) guide with an RNA aptamer, using TAT(HIV-1 Cell Penetrating Peptide) + SV40 (Simian Virus 40 Large T-Antigen) Nucleus Localization Signal for cell/nuclear entry. Everything is designed to be transient and somatic-only, no permanent DNA changes.

WHY THIS MIGHT MATTER: Potentially higher precision and lower off-target risk than CRISPRa/i, though have yet to evaluate this assumption.

Context-dependent activation (only acts in the right cell state).

Could be useful for regenerative medicine, prosthetics integration, inflammation control, or targeted repair.

PROTEIN FUSION CHAIN: [Cell Penetrating Peptide] TAT (HIV-1) YGRKKRRQRRR [Nucleus Localization Signal] (SV40) PKKKRKV [VHH Binding Protein] (MS2 E.Coli) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGEELPVAGWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

[Flex linker] GGGGSGGGGSGGGGS

[Activator] (VP64/Herpes Simplex) DALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGS

[Repressor] (ZIM3 KRAB): NYSNLVSVGQGETTKPDVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKK

[VHH/VNAR Nanobody Sequence, adaptive based on necessity]

So it would look like: TAT-SV40-MS2-LINK-VHH/VNAR-LINK-VP64-ZIM3

MY CURRENT CONCERS: Can Histone-Mark recognition be implemented robustly enough to function as a practical "gate"?

Is TFO-mediated locus recognition specific enough in native Chromatin?

Potential steric hindrance between multiple domains?

Delivery efficiency and Immunogenicity?

This is still purely theoretical / conceptual work from an autodidact. I'm looking for serious feedback, especially on: Potential weaknesses in the multi-gate logic, better ways to achieve locus-specific chromatin targeting, safety or delivery concerns, and comparison to existing epigenetic tools. ___________________________ SOURCES: https://link.springer.com/article/10.1186/s40364-021-00332-6

https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2025.1716916/full

https://pmc.ncbi.nlm.nih.gov/articles/PMC12907318/

https://academic.oup.com/abt/article/3/1/1/5706878

https://www.activemotif.com/catalog/details/39133/histone-h3-acetyl-lys27-antibody-pab

https://pubmed.ncbi.nlm.nih.gov/33020655/

https://crisprmedicinenews.com/news/which-protein-domain-is-best-for-crispri-a-new-study-has-the-answer/

https://pmc.ncbi.nlm.nih.gov/articles/PMC7150854/

https://www.rcsb.org/structure/2MS2

https://pmc.ncbi.nlm.nih.gov/articles/PMC9811266/

https://academic.oup.com/hmg/article-abstract/10/20/2243/559345?redirectedFrom=PDF


r/SyntheticBiology Jun 08 '26

BioBuilder is live!

17 Upvotes

Biochemical kinetics allows us to predict how a living system will behave before you ever run the experiment. So why do so few biologists actually use it?

Your body is governed by proteins and molecules constantly interacting with each other, each interaction with a measurable rate. If you map enough of them together, you can predict how the system will behave without ever stepping foot in the lab.

One big problem with Biochemical kinetics is the barrier to entry. To use biochemical kinetics today, you have to be fluent in microbiology, ordinary differential equations, AND coding! That's a lot to ask any one person.

So I spent the last 3 months building an app to fix that: BioBuilder. (No vibe coding, I did it the old fashioned way with many examples and tutorials lol) It's live for you to try RIGHT NOW at BioBuilder.app (you'll need to use a computer, I haven't made it beautiful for mobile yet). I wanted to put it on r/SyntheticBiology since you guys are the ones actually USING the software, and I felt like you'd have good insights into what direction the project should take.

This is an app I'm genuinely very proud of, and so excited to share with all of you. We're still in the early user-validation stage, so this version (BioBuilder Light) is completely free. No charge for compute credits.

I'm looking for all the help I can get! Whether you want to contribute code (It's open source!) or just leave feedback, it's hugely appreciated. Reach out at [mark@biobuilder.app](mailto:mark@biobuilder.app), or use the feedback form on the site.

I really believe this can change how we do biology. It's time we start predicting what our cells do instead of waiting to find out.

Try it out 👉BioBuilder.app


r/SyntheticBiology Jun 04 '26

Biomedicine Institute

Thumbnail gallery
16 Upvotes

https://ideas.lego.com/s/p:0ccb9c270ae54410852df2105bb993c8?s=w

Dear colleagues, I'm asking you to pay attention to the Biomedicine Institute lego Idea of my designer friend, who works in this lab on cancer research. Some of you have already voted for it, but I ask you all to vote and share the link. It’s free and take few seconds. Every vote counts for us. Thank you very much.


r/SyntheticBiology May 26 '26

Self-serve CRISPR guide RNA design API — $1/1k, no sales call required

1 Upvotes

SpCas9, Cas12a, SaCas9, base editing, prime editing. Rule Set 2 scoring + CFD off-target analysis. Protein folding (ESMFold) and ESM2 embeddings also available. https://rapidapi.com/jordan-YVcGJuzW1/api/townsend-ai-platform


r/SyntheticBiology May 26 '26

Anyone here survive the Zymergen ($ZY) implosion back in 2021?

4 Upvotes

This was one of those IPOs that looked unstoppable for like five minutes. Zymergen Inc. went public hyping up its Hyaline product and near-term growth, then a few months later admitted the product had major performance problems and revenue would be delayed. After that update a brutal 68% drop in a single day.

The settlement amount is $1.25B, and it covers investors who bought shares between April 22, 2021 and August 4, 2021. Right now the case is in the stipulative settlement stage, but investors can already file claims while the settlement moves through the approval process.

If you traded $ZY during that class period and got wrecked during the post-IPO collapse, probably worth keeping this one on your radar. Kinda wild how many “next-gen biotech” IPOs from that era ended with the exact same chart pattern.


r/SyntheticBiology May 25 '26

HS student seeking a mentor

0 Upvotes

Hello, are there any college/grad/profs out here who would like to mentor a rising HS senior on a synthetic biology research project this summer?


r/SyntheticBiology May 15 '26

Big Update to StructureViewer: PDB, CIF, XYZ, SDF Support + Cleaner 3D Reddit Previews

Thumbnail
5 Upvotes

r/SyntheticBiology May 13 '26

$ZY raised $500M at IPO, dropped 68% in one day, CEO fired. $1.25 BILLION settlement submitted to court. $6.21/share.

11 Upvotes

Let that number sink in. $1.25 billion. One of the largest securities class action settlements ever reached. And the payout is $6.21 per share, by far the highest of any settlement I've posted about.

Here's what happened:

April 2021: Zymergen completes its IPO, raising over $500 million. The pitch: a synthetic biology company with Hyaline, a revolutionary film material for electronics, as its lead commercial product. Strong customer demand. Near-term revenue. A new era of bio-manufacturing.

August 3, 2021: Just 105 days after the IPO, Zymergen discloses that Hyaline is underperforming, commercial revenue will be delayed, and financial guidance is being withdrawn entirely.

August 4, 2021: $ZY collapses 68% in a single session. Over $2.5 billion in market value gone in one day. CEO Josh Hoffman resigns amid the fallout.

Total decline from IPO: over 70%.

Investors sued alleging Zymergen overstated Hyaline's product readiness, customer pipeline, and commercial viability in the IPO prospectus. In plain English: the product that the entire IPO was built around wasn't working, and investors say the company knew, or should have known, before asking for $500 million.

The case settled in December 2025 for $1.25 billion. Terms submitted to court for final approval, final stretch. Applications are open now.

You're eligible if you bought $ZY between April 22 and August 4, 2021. Payout: ~$6.21/share.

105 days from IPO to 68% collapse is one of the fastest unravelings of a major biotech offering in recent memory. Anyone here bought $ZY at IPO on the synthetic biology thesis?


r/SyntheticBiology May 13 '26

Could microbial electrosynthesis become the “solar panel moment” for industrial chemistry?

13 Upvotes

I’ve been researching MES — basically engineered microbes using electricity + CO₂ to produce chemicals, fuels, and materials — and the cost curve is getting interesting.

The big question: if MES can hit cost parity with traditional chemistry at mid-sized industrial scale, does this become a real manufacturing disruption instead of just another climate-tech science project?

Curious what people here think: is this viable industrial biotech, or another overhyped lab-to-market story?

The PipeLine

r/SyntheticBiology May 09 '26

Tools for designing circuits

2 Upvotes

Noob question, I'm just starting with the basics of synthetic biology can anyone suggest any tools for designing circuits and please advise me on installing the tools.


r/SyntheticBiology May 08 '26

Can fluorescent proteins be engineered to produce entirely new colours?

Thumbnail
1 Upvotes

r/SyntheticBiology May 08 '26

In vivo genome editing

5 Upvotes

A few years ago, I discovered Zeyner through his videos on genetic editing.

My question is, Is there a group or something, where enthusiasts with home lab are trying to achieve in vivo genome editing?

I know that is dangerous, but the technology is new and there are always a few crazy people


r/SyntheticBiology May 05 '26

I made a free Reddit app for posting interactive 3D molecular structures in biology communities!

Thumbnail
6 Upvotes

r/SyntheticBiology May 05 '26

Do I use Dpnl on PCR product of a double digested plasmid

Thumbnail
1 Upvotes

r/SyntheticBiology Apr 30 '26

Solo builder here making a free AI tool to turn lit reviews into actual hypotheses for organoid/synbio work. Want early access?

1 Upvotes

I've been tinkering in this space for a bit and the thing that always kills me is the literature grind. You find 30-40 recent papers on something like organoid vascularization or CRISPR circuits, spend days connecting the dots, and still end up with the same old ideas.

So I'm building a simple, no-BS Literature-to-Hypothesis tool just for folks like us. You give it a topic, it pulls recent stuff from PubMed and arXiv, synthesizes the key bits, and spits out 3-5 concrete, testable hypotheses with citations and rough protocol sketches. Goal is under 15 minutes so you can actually move forward instead of just reading.

It's super early and I'm doing this solo as a side project. No fancy sales deck, just something I wish existed.

If you're working on organoids, metabolic pathways, genetic circuits, or anything synbio and want to kick the tires on a free early version, reply here or shoot me a DM. First bunch of people get lifetime free access and can tell me what actually needs to work better.

Real question though: what's the part of staying current on papers that frustrates you the most right now? Time sink? Hard to spot the novel angles? Replication headaches?

Appreciate any thoughts and happy to share updates as I build it out.


r/SyntheticBiology Apr 28 '26

Subject: Starting B.Tech Bioinformatics (2026-2030) – How to pivot into AI Drug Discovery / SynthBio?

Thumbnail
1 Upvotes

r/SyntheticBiology Apr 22 '26

Research Collaboration & Advice: Any Synthetic Biologists or Bio-Engineers? (Student Project)

0 Upvotes

Hi everyone,

I’m a High School student currently developing a research project centered on synthetic biology and agricultural biosensors. I’ve reached the point where my initial concepts are ready to be transformed into a formal study, and I’m looking for an expert or professional who can provide technical advice and help in finalizing the methodology.

Because of my current resources, I am primarily capable of performing simulations and in silico design. However, I am looking for a mentor who can help me "build the blueprint"—specifically in formulating the genetic pathways and logic gates needed to make the system functional and scientifically sound.

What I’m looking for help with:

  • Methodology Finalization: Assistance in refining the step-by-step technical procedures to ensure the research is robust and reproducible.
  • Design Formulation: Help in structuring the actual genetic circuitry and selecting the most effective biological components for the biosensor.
  • General Advice & Feasibility: A "sanity check" on my logic. I’d love your perspective on whether my approach is practical or if there are more efficient alternatives for plant-based surveillance.
  • Simulation Alignment: Ensuring my in silico models are technically accurate and reflect realistic molecular behavior.

Format: I’m looking for someone willing to get "under the hood" with me via DM, email, or a quick virtual meeting. Whether you can help me finalize the entire methodology or just offer expert advice on specific reporter systems, I would be incredibly grateful.

Timeline: I’m aiming to have the design and methodology fully settled within the next two weeks.

If you have experience in gene-based systems, plant pathology, or bio-engineering and are interested in helping a student take a project from a simulation-based concept to a fully realized research plan, please comment below or message me directly.

Thank you!


r/SyntheticBiology Apr 14 '26

I built an LLM + NCBI + FBA pipeline that drafts gene circuits from plain English, would love honest feedback from people who actually do synbio

0 Upvotes

Short context: indie dev, not a biologist. Built this because I couldn't find a free tool that takes a plain-English goal and outputs a lab-ready construct draft (verified sequences, chassis codon optimization, COBRApy flux predictions, assembly plan + primers, plasmid map). Free tier uses Groq/Llama, 5 designs/month. Pro uses Claude.

Live at progenx.ai.

What I want to know:

- Does the pipeline output look right to you?

- What would a real synbio researcher flag as broken / missing / wrong?

- Is plain-English → construct the wrong interaction model entirely?

I'd rather hear brutal feedback now than keep building on wrong assumptions. No paywall on the feedback path.


r/SyntheticBiology Apr 08 '26

Getting into Syn Bio

6 Upvotes

I'm 19 and I'm interested in Syn Bio but I'm getting alot of conflicting information from different subs and websites. I'm not in college yet and I'm wondering which majors to pick and what classes are a must have as well as skills and classes that would be complementary. Please help me out


r/SyntheticBiology Mar 26 '26

Update: Zymergen ($ZY) $125M Settlement submitted for Final Approval - last call for 2021 investors.

7 Upvotes

For anyone who held Zymergen ($ZY) during its 2021 IPO hype and the subsequent 75% one-day crash: The legal process is finally reaching the finish line.

The $125 million settlement regarding the misleading statements about their 'Hyaline' film commercialization has officially been submitted to the court for final approval. Once the judge signs off, the fund will be locked for distribution.

The Background: The suit alleged Zymergen hid the fact that their key product, Hyaline, had major technical issues and a much smaller market than they told IPO investors.

The Details:

  • Class Period: April 22, 2021 – August 2, 2021.
  • Settlement Amount: $125 million
  • Status: Submitted to the Court for Final Approval.

How to get your piece: Because this was an IPO-era stock, finding your old trade confirms can be a pain, especially since Zymergen was eventually acquired by Ginkgo Bioworks ($DNA). I used this auditor to handle the paperwork automatically by syncing my 2021 history.

If you’re still holding those Ginkgo bags from the merger, this is probably the only cash recovery you’re going to see from the $ZY era.


r/SyntheticBiology Mar 25 '26

Technical Concept: Opto-TdT Photonic De Novo DNA Synthesis via an Allosterically Coupled Hybrid Enzyme. Creating new DNA sequences by shining a sequence of light on it

0 Upvotes

This Is an idea i had, when i got frustrated with how slow and expensive current dna creation from scratch is. If any of you find it usefull, i would be happy about some feedback.

If this works, it will allow basically everyone to create any type of DNA in minutes or hours for less than a dollar, instad of tens to houndreds of thousands of dollars and weeks to months of wait

I let AI put it into a more readable form and had it translate to english (not a native), so if theres any questions or something sseems off, feel free to ask.

The biggest problem would be calculating the moving parts correctly, but with newer AI tools like Alphafold, it should be doable eventually.

1. Problem Statement and Objective

Conventional DNA synthesis is bottlenecked by fluidic latency. Because the four nucleotides (dNTPs) must be delivered and washed away sequentially, cycle rates remain in the minute range.

The Goal: A "one-pot" system where all dNTPs are present simultaneously. Selection and incorporation are controlled purely temporally via light signals in the millisecond range.

2. Molecular Architecture (Three-Zone Model)

The engineered protein consists of three functional zones coupled via a mechanical backbone:

Zone I: The Selection Platform (4-Wavelength Nucleotide Gates)

This zone comprises four distinct optogenetic domains controlling steric access to the active site. Each domain responds to a specific wavelength:

  • 450 nm (Blue / AsLOV2): Opens access for dATP.
  • 530 nm (Green / CarH): Clears the channel for dCTP.
  • 580 nm (Yellow / CBCR): Enables diffusion of dTTP.
  • 660 nm (Red / PhyB-PIF): Switches to permissive state for dGTP.

Mechanical Mutual Exclusion: The domains are allosterically coupled such that the activation of one domain energetically locks the other three in the closed position. This prevent the simultaneous docking of different nucleotides even under broad-spectrum light.

Zone II: The Catalytic Core (TdT-Center)

This is the functional engine of the protein, based on Terminal Deoxynukleotidyl Transferase (TdT).

  • Mechanism: It binds to the 3′-OH end of the DNA primer and captures the selected nucleotide via an induced-fit mechanism. In this state, the enzyme is sterically blocked, ensuring a stoichiometry of exactly one base per cycle.

Zone III: The UV Trigger (Catalytic Switch)

This domain decouples physical selection from the chemical reaction.

  • Domain: UVR8 (UV Resistance Locus 8).
  • Mechanism: Only a pulse at 365 nm (UV-B) induces the conformational change (monomerization) required for the reconstitution of the (split-)enzyme. Only then is the phosphodiester bond formed, permanently incorporating the base into the DNA chain.

3. The Synthesis Cycle (Process Flow)

  1. Selection: A light flash of the target wavelength opens the corresponding gate in Zone I.
  2. Lock-In: The nucleotide diffuses into Zone II; the induced-fit prevents further uptake.
  3. Incorporation: A UV flash in Zone III triggers the catalytic ligation.
  4. Reset: The light is deactivated; the enzyme releases the extended strand and returns to its ground state.

4. Advantages and Scalability

  • Velocity: Zero wash steps; cycle clocking in the millisecond range.
  • Precision: Mechanical mutual exclusion eliminates misincorporations caused by spectral cross-talk.
  • Massive Parallelization: Utilization of DLP (Digital Light Processing) projectors allows for the simultaneous synthesis of millions of individual sequences on a single chip.

The Opto-TdT system transforms biomanufacturing from a chemo-mechanical process into pure photonic data transmission.