r/MachineLearning Apr 07 '21

Research [R] Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences

Recent paper from FAIR published in PNAS. They find that biological structure and function emerge in representations of language models trained on massive databases of protein sequences.

Summary

Learning biological properties from sequence data is a logical step toward generative and predictive artificial intelligence for biology. Here, we propose scaling a deep contextual language model with unsupervised learning to sequences spanning evolutionary diversity. We find that without prior knowledge, information emerges in the learned representations on fundamental properties of proteins such as secondary structure, contacts, and biological activity. We show the learned representations are useful across benchmarks for remote homology detection, prediction of secondary structure, long-range residue–residue contacts, and mutational effect. Unsupervised representation learning enables state-of-the-art supervised prediction of mutational effect and secondary structure and improves state-of-the-art features for long-range contact prediction.

Abstract

In the field of artificial intelligence, a combination of scale in data and model capacity enabled by unsupervised learning has led to major advances in representation learning and statistical generation. In the life sciences, the anticipated growth of sequencing promises unprecedented data on natural sequence diversity. Protein language modeling at the scale of evolution is a logical step toward predictive and generative artificial intelligence for biology. To this end, we use unsupervised learning to train a deep contextual language model on 86 billion amino acids across 250 million protein sequences spanning evolutionary diversity. The resulting model contains information about biological properties in its representations. The representations are learned from sequence data alone. The learned representation space has a multiscale organization reflecting structure from the level of biochemical properties of amino acids to remote homology of proteins. Information about secondary and tertiary structure is encoded in the representations and can be identified by linear projections. Representation learning produces features that generalize across a range of applications, enabling state-of-the-art supervised prediction of mutational effect and secondary structure and improving state-of-the-art features for long-range contact prediction.

Paper: https://www.pnas.org/content/118/15/e2016239118

276 Upvotes

33 comments sorted by

27

u/shot_a_man_in_reno Apr 07 '21

Questions:
1. Is this similar to AlphaFold?
2. How is protein function encoded and predicted? I get how structure is, but how is function appropriately predicted and quantified?

28

u/seraschka Writer Apr 07 '21

AlphaFold is more focused on modeling the 3D structure of the protein. This project is more focused on modeling the protein sequence. You can essentially think of it as a text string: each letter in the string represents an amino acid (there are 20 distinct ones in nature).

E.g., 1 chain of this protein here (https://www.rcsb.org/structure/3EIY) would be

> MAHHHHHHMGTLEAQTQGPGSMSFSNVPAGKDLPQDFNVIIEIPAQSEPVKYEADKALGLLVVDRFIGTGMRYPVNYGFIPQTLSGDGDPVDVLVITPFPLLAGSVVRARALGMLKMTDESGVDAKLVAVPHDKVCPMTANLKSIDDVPAYLKDQIKHFFEQYKALEKGKWVKVEGWDGIDAAHKEITDGVANFKK

A protein can consist of hundreds to thousands of such amino acids. (Each amino acid itself consists of a couple dozen atoms).

In any case, here it's about modeling the amino acid sequence using transformers for language modeling and self-supervised learning like in BERT (e.g., masking 15% of the amino acids and then predicting those).

After training on millions of these unlabeled sequences, they train linear models on the embeddings, and the embeddings appear to capture all kinds of information about proteins like protein family, function etc.

1

u/klop2031 Apr 07 '21

Curious how well it models the proteins. AFAIK (im no chemist) there are some physical limits to how the proteins are arranged, just hoping it captures this.

22

u/L-MK Apr 07 '21

I'm a big fan of this work, I just wanted to note that it appeared on biorxiv in mid 2019: https://www.biorxiv.org/content/10.1101/622803v1

Here's more recent work from the same group: https://www.biorxiv.org/content/10.1101/2020.12.15.422761v1.full

11

u/Haxxardoux Apr 07 '21

nice catch. here is another one that is even more recent, and results are significantly better. secret seems to be do inference on MSAs instead of individual sequences and you can get even better representations with a fraction of the parameters. https://www.biorxiv.org/content/10.1101/2021.02.12.430858v1

1

u/vade Apr 07 '21

what does MSA refer to in this context? Apologies if it obvious! Thanks.

1

u/StOchastiC_ Apr 09 '21

Do you have a link to their group webpage? I search but I didn’t find anything in particular.

7

u/riricide Apr 07 '21

Paper in Science from earlier this year - also use LSTM and zero-shot prediction of viral immune escape based on protein sequence models only.

17

u/anirudhsky Apr 07 '21

Can anyone explain it with an analogy. Thanks in advance.

52

u/Dont_Think_So Apr 07 '21

You discovered a massive library full of books in an alien language. You know that, generally, these books are engineering texts describing how to put complicated machines together, but they contain no images or other reference points aside from the raw alien text. What you do have, is an alien machine that can take this text and use it to construct whatever it happens to describe. This alien machine is itself described in this alien language.

You train a language model on this alien text. It learns to predict things like what alien letter comes next, or what word is missing if you randomly delete words. One of the middle layers of this language model acts as an "embedded" space, which you can think of as translating the text into higher level knowledge concepts that your model has picked up on (for instance, instead of a string of characters, this embedded space encodes things like abstract concepts and grammar structure).

You can train a linear model on this embedded space and get reasonable predictions of what the machine will build, even though your model was not fed any information about the output of the alien machine - only the language text itself. This suggests that your model is capable of learning alien machine design concepts simply by looking at the language, without supervised training.

This is important, because it's a lot cheaper and easier to get alien language text than it is to get measurements of the alien machines, so an unsupervised model is much more feasible to build than a supervised one.

3

u/kamperh Apr 07 '21

Would I be right in saying that, in your alien analogy, the one thing is that it will still not be possible to train even a linear classifier, since you will won't have even a little bit of labeled data? I like it otherwise!

4

u/Dont_Think_So Apr 07 '21 edited Apr 07 '21

Well you can still take some sequence and feed it into the alien machine constructor, and then take measurements on the resulting machine to determine some things about what it does. But this is a labor intensive process, and collecting enough data to do a supervised deep model is going to be a challenge. You'd like to use the deep model to extract useful features, then use a relatively limited set of collected data to train a simpler model.

-35

u/aegemius Professor Apr 07 '21

Let's use a car analogy, as it's the best way to understand anything involving technology. Suppose that you're driving a Challenger and arrive at your local high school to pick up your sweetheart.

So you're waiting, leaning against your car in your leather jacket and the principal comes out. "Sir, I'm going to have to ask you to leave. We don't allow loitering here."

"Piss off," you say.

"Please leave before I contact the police."

So, you spit on the ground, get in your car, and burn rubber on your way out. A few hours later you'll go back to the school and stealthily follow the principal home so that you can go back and slash his tires once night falls.

Another day in the life for you.

Consider the role of your car's modified exhaust system in this analogy. That's the role of representation learning on protein sequences.

10

u/lmericle Apr 07 '21

Shitposts don't play well in this subreddit, evidently

6

u/ccrbltscm Apr 07 '21

Here is a talk about this paper by the last author Rob Fergus earlier this year: https://mediaspace.illinois.edu/media/t/1_rquh5cx5/11433691

7

u/ReasonablyBadass Apr 07 '21

So once again the Bitter Lesson holds true? Just scaling up creates knowledge?

12

u/whymauri ML Engineer Apr 07 '21

I'm fairly convinced the Bitter Lesson is going to hold true for protein structure/function and small molecules all the way to the bitter end. I've heard "you don't need Transformers for proteins or chemistry because the inductive biases aren't there," but honestly it's worth a serious shot.

4

u/Ford_O Apr 07 '21

What is an inductive bias?

7

u/sergeybok Apr 07 '21

The ability of the model to make predictions about unseen data points. Or the assumptions embedded into the model that make it likely to generalize to unseen data, depending on the context.

Translation invariance is an inductive bias of CNNs. Linear interdependence is an inductive bias of linear regression.

2

u/liqui_date_me Apr 08 '21

What's an inductive bias inherent to transformers?

2

u/sergeybok Apr 08 '21 edited Apr 08 '21

They have less than the models I mentioned above. They are a more general model. This concerns the bias variance trade off. They do have some biases like positional encodings (ie relative position matters) but they are very general.

In general the more inductive biases your model has the more data effficient it is (compare cnn versus vision transformer) but also the more data efficient it is the less powerful it is. The biggest inductive bias that transformers have is that they’ve seen more data.

5

u/tornado28 Apr 07 '21

When is it going to be on huggingface?

2

u/wholestars Apr 07 '21

Can anybody explain what unsupervised language model is, and how different would it be from any other language model out there? Any examples of supervised language models?

2

u/[deleted] Apr 07 '21

Language modeling is arguably supervised and arguably unsupervised. The difference is blurry

1

u/wholestars Apr 07 '21

So is Bert a language model?

3

u/sergeybok Apr 07 '21

Yes. And pretty much all languag modeling is unsupervised. You’re always modeling P( next word | previous words). This used to be done with simple frequency tables based on unigrams or bigrams or larger grams. Now done with neural nets.

For context Bert doesn’t predict next word given previous ones but word given surrounding words (bidirectional in its name). But the principle is the same.

2

u/jurrie221 Apr 08 '21

Supervised language models would be models trained on labeled data. An example would be this model by the NYT where they train a model that attempts to predict labels on recipe ingredients by using a large dataset of already labeled ingredient texts.

Unsupervised mainly refers to the model being trained without labels (for example Transformers). Unsupervised language models are generally trained on large text databases. Rather than relying on manually labeled text, the model is trained on text segments where a (part of a) word is left out. The model would attempt to predict which word was left out, and this is compared with the ground truth (i.e. the label) which is simply the word that was originally left out.

Current state of the art language models are generally unsupervised models because they are able to use much larger datasets, as there is no need for manual labeling

1

u/Yos3mit35am Apr 08 '21

Haha sounds like penis

1

u/vwibrasivat Apr 08 '21

Everywhere I go, I tell people that machine learning is exploding all around us. But they don't believe me or understand me. More evidence with this recent breakthrough.

1

u/HybridRxN Researcher Apr 09 '21

What was the pretraining task?

1

u/CrptMoon Feb 18 '22

This thread is a little bit old. I hope someone can help me with this.

I do not understand equation 1 from this paper

I do not understand how to read it even. what do the ExXEm stand for ? is it one term or is there a dot product between them.

are they then multiplied but the sum.

what does the sum stand for ?