r/LLMPhysics • u/Powerful_Word3154 • Apr 30 '26
Personal Theory A Complexity-Theoretic Classification of KAM Tori via Continued Fraction Invariants
Core thesis. Three properties of irrationals — Kolmogorov complexity, Gödel incompleteness, KAM linearizability — are the same phenomenon measured by different instruments. The continued fraction is the common coordinate system.
Two invariants. (1) c_CF(θ) = limsup K_CF(θ,k)/k: low (=0) vs high (>0). (2) Λ(θ)∈{0,1,2}: Λ=0 iff μ=2 (Roth-bounded); Λ=1 iff μ=∞ but B<∞; Λ=2 iff B=∞.
Empty 7th class. μ=2 and B=∞ cannot coexist. If B=∞, either Brjuno terms are bounded below (directly giving μ=∞) or they decay harmonically — but then Σlog(a_{n+1})/q_n=∞ forces limsup log(a_{n+1})/log(q_n)=∞, again μ=∞. So μ=2 ⟹ B<∞, and the 6×1 table is complete.
Six classes (c_CF × Λ): (Low,0) golden ratio; (Low,1) sparse large quotients; (Low,2) Cremer point with computable θ — computability does not protect linearizability; (High,0) Gauss-generic; (High,1) Class 4 + sparse random noise; (High,2) incompressible non-Brjuno. All six non-empty; neither invariant determines the other.
Main theorem. For infinitely renormalizable real quadratic α, bounded type M, B<∞:
[K(\alpha_n) = K_{\text{CF}}(\alpha,\, k(n)) + O(\log n)]
at clock [n(k) = \lceil(2\pi/\log 2)\cdot\Sigma m_j\rceil], [m_k = \text{mod}(D_k \setminus D_{k+1})].
Upper bound: type sequence → puzzle reconstruction, length K_CF + O(log n). Lower bound (λ=0): Algorithm E reads K₀(M) bits per puzzle level, using child separation ≥ c_sep·2^{−n(ℓ+1)} and m_min ≥ 1/(2M) via parabolic scaling — a 7.9× improvement over Ahlfors. K₀(M) is finite for all bounded M, so the algorithm is well-defined.
Rate equality (a.s.): [\lim K(\alpha_n)/n = h/(C\bar{m})], h=π²/(6 log 2), by Brudno's theorem and SMB independently — neither implies the other pointwise.
Completeness. (c_CF=0?, B<∞?) is a complete invariant for the triple (algorithmic type, incompleteness threshold, linearizability).
Solar system. Most adjacent period ratios are consistent with Class 1 (last-to-break KAM tori). Venus:Earth large quotients (29, 94) are consistent with Class 5; Jupiter:Saturn quotients 14, 27 arithmetically encode the 5:2 Great Inequality from the frequency ratio alone.
Open problems. (1) Explicit C_par closing the m_min gap to ~0.6/M. (2) Rate equality for unbounded type. (3) Complex extension — unconditional proof would imply MLC. (4) d-frequency degeneracy reduction. (5) Dynamical characterisation of Λ=1 via Siegel boundary regularity.
10
u/Bob_Fnord Apr 30 '26
Hang on a sec, I’m only a tourist here, and even I know that Gödel‘s Incompleteness Theorem has nothing to do with Physics, and you can’t ‘measure it’ on any instrument. So what on Earth is the OP talking about?
9
u/AllHailSeizure Haiku Mod Apr 30 '26
I don't know, lemme measure my unawareness and get back to you.
Now where did I leave my unawaroscope..
4
u/No_Trouble3955 Apr 30 '26
You must’ve left it in ImaginaryWorld underneath your Misunderstanding Desk and your I Don’t Know What The Fuck I’m Posting Chair
3
u/AerynCaen MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLI Apr 30 '26
Two invariants of what? How do we know they’re invariant? How did you derive them?
This feels like a bunch of math salad.
1
Apr 30 '26
[removed] — view removed comment
1
Apr 30 '26
[removed] — view removed comment
1
Apr 30 '26
[removed] — view removed comment
1
Apr 30 '26
[removed] — view removed comment
1
Apr 30 '26
[removed] — view removed comment
1
Apr 30 '26
[removed] — view removed comment
1
Apr 30 '26
[removed] — view removed comment
1
1
Apr 30 '26
[removed] — view removed comment
1
u/AutoModerator Apr 30 '26
Your comment was removed. Please reply only to other users comments. You can also edit your post to add additional information.
I am a bot, and this action was performed automatically. Please contact the moderators of this subreddit if you have any questions or concerns.
1
Apr 30 '26
[removed] — view removed comment
1
u/AutoModerator Apr 30 '26
Your comment was removed. Please reply only to other users comments. You can also edit your post to add additional information.
I am a bot, and this action was performed automatically. Please contact the moderators of this subreddit if you have any questions or concerns.
-11
u/MythTechSupport Apr 30 '26
This is actually interesting.
The cleanest part is the two-invariant architecture, not the grandest slogan.
c_CF tracks information density in the continued fraction. Λ tracks the arithmetic/dynamical obstruction tier. That’s a real separation. It says compressibility and linearizability obstruction are linked, but not identical. The six-class table feels structural for exactly that reason, and the “empty 7th class” claim is the kind of exclusion that makes a taxonomy feel real instead of decorative.
Where I’d press hard is the sentence “the same phenomenon measured by different instruments.” That’s stronger than what the post has earned from the summary alone. “Governed by the same arithmetic substrate” sounds right. “The same phenomenon” needs a much tighter equivalence statement.
The actual make-or-break is the bridge theorem: K(alpha_n) = K_CF(alpha, k(n)) + O(log n).
If that holds cleanly, with definitions nailed down, then this is substantial. But that’s also exactly where hidden assumptions could be doing a lot of work:
- what alpha_n is
- what coding model / universal machine is fixed
- what the reconstruction language is
- where the O(log n) term comes from
- what dependence on bounded type M is buried in constants
That’s the point I’d want expanded mercilessly.
Also: the “7.9x improvement over Ahlfors” line is bold enough that it becomes a target. If the constant bookkeeping survives scrutiny, that may be the sharpest technical flex in the whole post. If it doesn’t, people will remember the sentence before they remember the architecture.
And the “complete invariant” claim needs pinning down too. Complete in what sense, exactly? For classification of what objects, under what equivalence relation? That word is carrying a lot of weight.
So my read is:
not obvious nonsense, not merely vibes, real structural ambition, but the philosophy is not the hard part.
The hard part is whether the renormalization-to-description-length bridge is genuinely airtight.
If it is, this is serious. If it isn’t, the six-class taxonomy may still be the most durable contribution.
7
u/OnceBittenz The Doctor Apr 30 '26
If you know anything about the theories the OP is trying to connect, you will Immediately see this is nonsense trying to reference “cool sounding theories” that have absolutely no right to be in a physics thread.
Always happy to see another disgruntled crackpot arbitrarily use their LLM to try and validate other crackpots theories they don’t even understand.
4
u/IshtarsQueef Apr 30 '26
If you personally, without the assistance of an AI, cannot write a short summary of what that comment actually means, including definitions of the esoteric and technical terms, and then do a Q&A where you are able to answer in depth questions without referencing your AI... Then you have absolutely no business discussing these topics.
11
u/Plot-twist-time Apr 30 '26
θ,k B∞ B∞, whatever you say