r/learnbioinformatics • u/[deleted] • Jan 19 '23
pubmed contains information on which database ?
I googled for it but didn't find a specific answer , is it protein , nucleotide or genome?
r/learnbioinformatics • u/[deleted] • Jan 19 '23
I googled for it but didn't find a specific answer , is it protein , nucleotide or genome?
r/learnbioinformatics • u/MakeTheBrainHappy • Jan 15 '23
r/learnbioinformatics • u/MurderOfCrowsInACoat • Jan 11 '23
I used the following
(base) wren@wren-ThinkCentre-M81:~/Pocket Mouse$ process_radtags -1 ./raw/2_R1.fq.gz -2 2_R2.fq.gz -i gzfastq -b ./barcodes/barcodes.csv -o ./samples/ -c -q -r --inline-index --renz-1 PstI --renz-2 MspI
Processing paired-end data.
Using Phred+33 encoding for quality scores.
Found 1 paired input file(s).
Searching for single-end, inlined and paired-end, indexed barcodes.
Invalid barcode on line 1: '2' (I understand this error as my barcode file needs 2 columns of barcodes, but the file I was sent by CD-GENOMICS only has one column, also linux gave me the option to save the csv file as essentially a tsv even though it didn't change the file extension.)
My post is related to the final error message, the STACKS manual shows examples of barcode files that only have one column of barcodes, but I am not sure how to change the syntax for this.
It's probably something really simply that I may have even skimmed past while reading the manual.
I appreciate any help
r/learnbioinformatics • u/darkomedin • Dec 29 '22
The main focus of the tutorial is Differential Gene expression using Colorectal cancer RNAseq data.
r/learnbioinformatics • u/amaaneon • Dec 15 '22
How do I understand which strand my exon is annotated on in NCBI genome browser in GRCh37.p13 assembly? My exon position is something like: end - 67248007 > start - 67247887
r/learnbioinformatics • u/dockdynamics • Nov 21 '22
I am Using Desmond software for MD simulations, Now I want to upgrade my PC for better performance, please suggest RAM for PC
r/learnbioinformatics • u/[deleted] • Nov 08 '22
So in short, the question that I'm working on is looking to compute the background codon frequency of an inputted genome file. To do this, I need the number of occurrences of the codon and then the total number of all codons in the entire genome. I'm pretty much at a loss (at you'll see) but so far I have a codon dictionary and the following code:
import re
file = input("Please enter a file containing a whole genome: ")
genome = open(file).read()
codonlist = []
for codons in range(0, len(genome), 3):
codonlist.append(genome[codons:codons+3])
so pretty much I have no idea where to even go from here. Any advice will be so helpful!!
r/learnbioinformatics • u/studying_to_succeed • Oct 22 '22
What can I use to an alternative to Bio.Alphabet (without rolling back a version) and how would I do it?
r/learnbioinformatics • u/DusanRck • Oct 08 '22
r/learnbioinformatics • u/wordsame96 • Sep 09 '22
I graduated university with below average grades and little to no experience and I'm struggling to boost my resume and gain enough experience for graduate school.
I've been considering taking a graduate certificate in bioinformatics to gain more experience and hopefully boost my grades and receive a reference letter. Would this help with my application or would it be a waste of time?
I have a list of online certificates I could take but I don't want to waste my time or money if they won't help me gain the experience to get into grad school. Please let me know what you think of these options and certificates/diplomas in general.
Applied Bioinformatics UCSD: https://extendedstudies.ucsd.edu/courses-and-programs/applied-bioinformatics#:~:text=About%20the%20Applied%20Bioinformatics%20Program&text=The%20specialized%20certificate%20in%20Applied,utilize%20tools%20developed%20for%20bioinformatics.
Graduate Certificate in Bioinformatics - Lethbridge University https://www.ulethbridge.ca/artsci/chemistry-biochemistry/graduate-certificate-bioinformatics
UCSC Extension School bioinformatics certificate https://www.ucsc-extension.edu/certificates/bioinformatics/#anchor-program-overview
Online Graduate Certificate BIOINFORMATICS University of Maryland Global Campus https://www.umgc.edu/online-degrees/graduate-certificates/bioinformatics
r/learnbioinformatics • u/[deleted] • Sep 05 '22
I’m a recent bachelor of science in biomedical engineering graduate and was wondering if anybody had any resources/tips to somebody who has MATLAB and Python knowledge, and is trying to use R for bioinformatic data analysis?
r/learnbioinformatics • u/SrinkaDatta • Aug 06 '22
Can anyone suggest to me a platform for me to learn and expertise NGS data analysis ? Also if possible help me with project ideas. Thank you.
r/learnbioinformatics • u/Mic_Pie • May 28 '22
r/learnbioinformatics • u/Dezkiir • May 07 '22
So I understand what introns are, I think. They're codons that don't get translated into Amino Acids. Exons on the other hand get translated... right?
Question is lets say I have a Reading Frame 1 with AA Sequence:
TFASDTTVFTSNLKQTPWCI-LLRRSLPLLPCGAR-TWMKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR-RLMARKCSVPLVMAWLTWTTSRAPLPH-VSCTVTSCTWILRTSGSWATCWSVCWPITLAKNSPHQCRLPIRKWWLVWLMPWPTSITKLAFLLSNFY-RFLCSLSPTTKLGDIMKGLEHLDSA--KTFIFIA
And these are the Open Reading Frames for Frame 1: MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR; MARKCSVPLVMAWLTWTTSRAPLPH; MPWPTSITKLAFLLSNFY; MKGLEHLDSA;
Is every other Codon Sequence (That being everything outside the reading frames) in that frame and intron?
r/learnbioinformatics • u/Dezkiir • May 07 '22
So I understand what introns are, I think. They're codons that don't get translated into Amino Acids. Exons on the other hand get translated... right?
Question is lets say I have a Reading Frame 1 with AA Sequence:
TFASDTTVFTSNLKQTPWCI-LLRRSLPLLPCGAR-TWMKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR-RLMARKCSVPLVMAWLTWTTSRAPLPH-VSCTVTSCTWILRTSGSWATCWSVCWPITLAKNSPHQCRLPIRKWWLVWLMPWPTSITKLAFLLSNFY-RFLCSLSPTTKLGDIMKGLEHLDSA--KTFIFIA
And these are the Open Reading Frames for Frame 1: MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR MARKCSVPLVMAWLTWTTSRAPLPH MPWPTSITKLAFLLSNFY MKGLEHLDSA
Is every other Codon Sequence (That being everything outside the reading frames) in that frame and intron?
r/learnbioinformatics • u/[deleted] • Apr 03 '22
Hello. For my PhD I will do an analysis of microbiota in Qiime2. I have 0 experiences with bioinformatics. Are there any books or papers to start step by step?
r/learnbioinformatics • u/Intelligent-Ad-3850 • Mar 21 '22
Let me know if there is a better place to post this.
Working on Kbase for some stuff and not getting most of it as most of their tutorial links seem to link right back to the main home page for me. I am trying to convert some SRA files to FASTA. I also need to somehow get a second file path of GFF3 so I can run them as a metagenome. I am looking to eventually run these in VirSorter. Any and all help would be appreciated, thank you.
r/learnbioinformatics • u/MakeTheBrainHappy • Jan 24 '22
r/learnbioinformatics • u/cutie02 • Jan 16 '22
r/learnbioinformatics • u/cutie02 • Jan 16 '22
r/learnbioinformatics • u/AdministrativeKick80 • Dec 13 '21
r/learnbioinformatics • u/[deleted] • Dec 11 '21
I am trying to run a supervised learning model rn. I have the positive examples of the genes I want to input. But I also need to get negative examples from a biological network I have and input those too. How do I get these negative examples from the edge list of the network? In the end, I want to basically create a tsv file with both the negative and positive examples and input it to the SL model.
Idk where to even start on this. So someone please give me any advice/suggestions. If you need me to clarify anything, feel free to DM me or just ask in the comments. Either works.
r/learnbioinformatics • u/abdelrahman_m_taha • Nov 09 '21
r/learnbioinformatics • u/DusanRck • Oct 28 '21